BLAST Results
BLASTP 2.2.28+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Salvia_miltiorrhiza.pep 34,575 sequences; 12,390,255 total letters Query= evm.model.C151063.1 gene=EVM%20prediction%20C151063.1 [translate_table: standard] Length=98 Score E Sequences producing significant alignments: (Bits) Value evm.model.C151063.1 gene=EVM%20prediction%20C151063.1 [translat... 186 7e-62 evm.model.scaffold9630.14 gene=EVM%20prediction%20scaffold9630.... 107 6e-31 evm.model.scaffold1675.7 gene=EVM%20prediction%20scaffold1675.7... 106 1e-30 evm.model.scaffold12134.4 gene=EVM%20prediction%20scaffold12134... 27.3 1.8 evm.model.scaffold3621.6 gene=EVM%20prediction%20scaffold3621.6... 26.6 2.7 evm.model.scaffold11044.1 gene=EVM%20prediction%20scaffold11044... 26.6 2.9 evm.model.scaffold9006.3 gene=EVM%20prediction%20scaffold9006.3... 25.4 6.7 evm.model.scaffold7937.1 gene=EVM%20prediction%20scaffold7937.1... 25.0 7.6 evm.model.scaffold2757.1 gene=EVM%20prediction%20scaffold2757.1... 25.0 8.1 > evm.model.C151063.1 on evm.model.C151063.1 gene=EVM%20prediction%20C151063.1 [translate_table: standard] Length=98 Score = 186 bits (473), Expect = 7e-62, Method: Compositional matrix adjust. Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%) Query 1 MCFVGEGRRGCTGWLREDEGGRAQVLPACWRRAKEKGAGVASVWRRGASTVAGGRGELLL 60 MCFVGEGRRGCTGWLREDEGGRAQVLPACWRRAKEKGAGVASVWRRGASTVAGGRGELLL Sbjct 1 MCFVGEGRRGCTGWLREDEGGRAQVLPACWRRAKEKGAGVASVWRRGASTVAGGRGELLL 60 Query 61 LAAPVCWRRRGGRRGRNVWSVESAECQNVWSIDGARAA 98 LAAPVCWRRRGGRRGRNVWSVESAECQNVWSIDGARAA Sbjct 61 LAAPVCWRRRGGRRGRNVWSVESAECQNVWSIDGARAA 98 > evm.model.C151063.1 on evm.model.scaffold9630.14 gene=EVM%20prediction%20scaffold9630.14 [translate_table: standard] Length=91 Score = 107 bits (268), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 59/66 (89%), Positives = 59/66 (89%), Gaps = 3/66 (5%) Query 1 MCFVGEGRRGCTGWLREDEGGRAQVLPA---CWRRAKEKGAGVASVWRRGASTVAGGRGE 57 MCFVGEGRRGCTGWLRED GGRAQV PA CWRRAKEKGAGVASVWRRGAS VAG RGE Sbjct 1 MCFVGEGRRGCTGWLREDAGGRAQVSPASPACWRRAKEKGAGVASVWRRGASAVAGSRGE 60 Query 58 LLLLAA 63 LLLLAA Sbjct 61 LLLLAA 66 > evm.model.C151063.1 on evm.model.scaffold1675.7 gene=EVM%20prediction%20scaffold1675.7 [translate_table: standard] Length=91 Score = 106 bits (265), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 58/66 (88%), Positives = 59/66 (89%), Gaps = 3/66 (5%) Query 1 MCFVGEGRRGCTGWLREDEGGRAQVLPA---CWRRAKEKGAGVASVWRRGASTVAGGRGE 57 MCFVGEGRRGCTGWLRED GGRAQVLPA CWRRAK+KGAGVASVWRRGA VAG RGE Sbjct 1 MCFVGEGRRGCTGWLREDAGGRAQVLPASPACWRRAKKKGAGVASVWRRGAFAVAGSRGE 60 Query 58 LLLLAA 63 LLLLAA Sbjct 61 LLLLAA 66 > evm.model.C151063.1 on evm.model.scaffold12134.4 gene=EVM%20prediction%20scaffold12134.4 [translate_table: standard] Length=347 Score = 27.3 bits (59), Expect = 1.8, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (53%), Gaps = 2/34 (6%) Query 49 STVAGGRGELLLLAAPVCWRRRGGRRGRNVWSVE 82 + GG G+L + AA WRRRG G W+ E Sbjct 11 TMTGGGGGQLAMTAAG--WRRRGTAGGAGWWAEE 42 > evm.model.C151063.1 on evm.model.scaffold3621.6 gene=EVM%20prediction%20scaffold3621.6 [translate_table: standard] Length=865 Score = 26.6 bits (57), Expect = 2.7, Method: Composition-based stats. Identities = 14/38 (37%), Positives = 18/38 (47%), Gaps = 4/38 (11%) Query 51 VAGGRGELLLLAAPVCWRRR----GGRRGRNVWSVESA 84 + GG L+L CWRRR G RR + V +S Sbjct 7 LVGGEEGRLMLGGDECWRRRTMGGGARRQQGVGGEDSG 44 > evm.model.C151063.1 on evm.model.scaffold11044.1 gene=EVM%20prediction%20scaffold11044.1 [translate_table: standard] Length=733 Score = 26.6 bits (57), Expect = 2.9, Method: Composition-based stats. Identities = 12/43 (28%), Positives = 21/43 (49%), Gaps = 3/43 (7%) Query 53 GGRGELLLLAAPVC--WRRRGGRRGR-NVWSVESAECQNVWSI 92 G +G + ++A W G + G +W VE+ C +W+I Sbjct 400 GHKGPVTTISAETTGQWIASGSKDGTVRIWEVETGRCLQIWNI 442 > evm.model.C151063.1 on evm.model.scaffold9006.3 gene=EVM%20prediction%20scaffold9006.3 [translate_table: standard] Length=339 Score = 25.4 bits (54), Expect = 6.7, Method: Composition-based stats. Identities = 15/43 (35%), Positives = 17/43 (40%), Gaps = 11/43 (26%) Query 42 SVWRRGASTVAGGRGELLLLAAPVCWRRRGGRRGRNVWSVESA 84 S WRRGAST +G WR G R W +A Sbjct 278 SSWRRGASTTSG-----------TGWRTPGSTGRRRTWPAPAA 309 > evm.model.C151063.1 on evm.model.scaffold7937.1 gene=EVM%20prediction%20scaffold7937.1 [translate_table: standard] Length=161 Score = 25.0 bits (53), Expect = 7.6, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%) Query 15 LREDEGGRAQVLPACWRRAKEKGAGVASVW 44 R D+ GR + LP CW E+G A+V+ Sbjct 23 TRRDDCGRRRWLPCCWHAVCERGRTAAAVY 52 > evm.model.C151063.1 on evm.model.scaffold2757.1 gene=EVM%20prediction%20scaffold2757.1 [translate_table: standard] Length=106 Score = 25.0 bits (53), Expect = 8.1, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 19/34 (56%), Gaps = 4/34 (12%) Query 39 GVASVWRRGASTVAGGRGELLLLAAPVCWRRRGG 72 G A +R S GGRG +AAP WRRRGG Sbjct 73 GDAQRRKREVSEEVGGRG----VAAPPPWRRRGG 102 Lambda K H a alpha 0.322 0.137 0.475 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 312285630 Database: Salvia_miltiorrhiza.pep Posted date: Jan 8, 2019 5:21 AM Number of letters in database: 12,390,255 Number of sequences in database: 34,575 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40