BLAST Results
BLASTX 2.2.28+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: Mentha_longifoli.pep 4,329 sequences; 1,311,348 total letters Query= lcl|NZ_CP014768.1_cds_2 [locus_tag=A0259_RS24275] [protein=beta-eliminating lyase] [pseudo=true] [location=207..780] [gbkey=CDS] Length=574 Score E Sequences producing significant alignments: (Bits) Value WP_001284618.1 MULTISPECIES: peptide-methionine (R)-S-oxide red... 28.1 0.25 WP_000628173.1 MULTISPECIES: pyruvate:ferredoxin (flavodoxin) o... 27.7 0.74 WP_001008049.1 MULTISPECIES: hypothetical protein [Enterobacter... 26.6 1.1 WP_001028965.1 MULTISPECIES: membrane protein [Enterobacteriaceae] 26.2 2.1 WP_000004024.1 MULTISPECIES: taurine dioxygenase [Enterobacteri... 25.0 4.0 WP_001295494.1 MULTISPECIES: cyclic di-GMP phosphodiesterase [P... 24.6 6.6 > lcl|NZ_CP014768.1_cds_2 on WP_001284618.1 MULTISPECIES: peptide-methionine (R)-S-oxide reductase [Proteobacteria] Length=137 Score = 28.1 bits (61), Expect = 0.25, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Frame = +3 Query 477 TCERERGRILKD*PLPTNQKYCVTS 551 C+ G + D P PT ++YCV S Sbjct 97 NCDAHLGHVFPDGPQPTGERYCVNS 121 > lcl|NZ_CP014768.1_cds_2 on WP_000628173.1 MULTISPECIES: pyruvate:ferredoxin (flavodoxin) oxidoreductase [Enterobacteriaceae] Length=1174 Score = 27.7 bits (60), Expect = 0.74, Method: Compositional matrix adjust. Identities = 11/36 (31%), Positives = 19/36 (53%), Gaps = 4/36 (11%) Frame = -1 Query 118 LPPDAP----SRRLPGRHMSGTLPAPRKGFCTRCTH 23 LPPD + R R+++ +P ++ CT+C H Sbjct 659 LPPDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNH 694 > lcl|NZ_CP014768.1_cds_2 on WP_001008049.1 MULTISPECIES: hypothetical protein [Enterobacteriaceae] Length=289 Score = 26.6 bits (57), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/28 (43%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -1 Query 424 EWLNAAVQPGMAVVYRFSDRGLTGKSQF 341 EW + +AV+YRF D +GK QF Sbjct 186 EWKHNLFDHYLAVLYRFKDE--SGKEQF 211 > lcl|NZ_CP014768.1_cds_2 on WP_001028965.1 MULTISPECIES: membrane protein [Enterobacteriaceae] Length=816 Score = 26.2 bits (56), Expect = 2.1, Method: Composition-based stats. Identities = 13/42 (31%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -1 Query 451 YVFEYMLRAEWLNAAVQPGMAVVYRFSDRGLTGKSQFLPHGY 326 Y F Y + + N+ + YRFSDR + +L H Y Sbjct 429 YRFNYSKQVDATNSTIS---LAAYRFSDRHFHSYANYLDHKY 467 > lcl|NZ_CP014768.1_cds_2 on WP_000004024.1 MULTISPECIES: taurine dioxygenase [Enterobacteriaceae] Length=283 Score = 25.0 bits (53), Expect = 4.0, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 12/18 (67%), Gaps = 0/18 (0%) Frame = +2 Query 272 RQTSSRHRRWRASCIKSP 325 R+T H+RWR + K+P Sbjct 165 RKTEEEHQRWREAVAKNP 182 > lcl|NZ_CP014768.1_cds_2 on WP_001295494.1 MULTISPECIES: cyclic di-GMP phosphodiesterase [Proteobacteria] Length=532 Score = 24.6 bits (52), Expect = 6.6, Method: Compositional matrix adjust. Identities = 11/16 (69%), Positives = 12/16 (75%), Gaps = 0/16 (0%) Frame = +1 Query 385 QLPCPAELLRLTIPRA 432 +LP P LLRLTI RA Sbjct 126 ELPAPQPLLRLTIDRA 141 Lambda K H a alpha 0.318 0.134 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110026518 Database: Mentha_longifoli.pep Posted date: Jan 8, 2019 3:07 AM Number of letters in database: 1,311,348 Number of sequences in database: 4,329 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 12 Window for multiple hits: 40